PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602856.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89821.7 Da    PI: 5.9825
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602856.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.8e-21123178156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  XP_009602856.1 123 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 178
                     688999***********************************************999 PP

2START202.12.3e-633305541206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++e+vk+a+ +ep+W++s+    e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t+
  XP_009602856.1 330 ELALAAMDEFVKMAQTDEPLWFRSVeggrEILNHEEYMRSFTSCIGmrpnsFVSEASRETGMVIINSLALVETLMDSN-KWAEMFPcliaRTSTT 423
                     5899*************************************988889***9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++ + +  ++ lpSg+l+++++ng+skvtwveh 
  XP_009602856.1 424 DVISSGmggtrnGALQLMHAELQVLSPLVPiREVNFLRFCKQHAEGVWAVVDVSIDTIRETSNAPTFPNSRILPSGCLVQDMPNGYSKVTWVEHG 518
                     *************************************************************99******************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h l+r+l++ g+ +ga++wvatlqrqce+
  XP_009602856.1 519 EYDESVIHHLYRPLISAGMGFGAQRWVATLQRQCEC 554
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.46E-20109180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-21109174IPR009057Homeodomain-like
PROSITE profilePS5007117.637120180IPR001356Homeobox domain
SMARTSM003895.2E-19121184IPR001356Homeobox domain
CDDcd000865.34E-19122180No hitNo description
PfamPF000461.7E-18123178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PROSITE profilePS5084842.638321557IPR002913START domain
SuperFamilySSF559612.84E-32323554No hitNo description
CDDcd088752.75E-124325553No hitNo description
PfamPF018525.3E-55330554IPR002913START domain
SMARTSM002345.0E-48330554IPR002913START domain
SuperFamilySSF559612.2E-23573807No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MNFGDFLDNT SGGGGARIVA DIPFNNNSNS SNNNNMPAGA ISQPRLLTQS LAKSMFNSPG  60
LSLALQTGME GQSEVTRMAE NYEGNNSNGR RSREEEPDSR SGSDNLEGAS GDDQDAADKP  120
PRKKRYHRHT PQQIQELESL FKECPHPDEK QRLELSKRLS LETRQVKFWF QNRRTQMKTQ  180
LERHENSILR QENDKLRAEN MSIREAMRNP ICTNCGGPAM IGEISLEEQH LRIENARLKD  240
ELDRVCALAG KFLGRPISSL VNSMPPPMPN SSLELGVGNN GFGGLSNVPS TLPLAPPDFG  300
VGISNSLPVV ASTRQTTGIE RSLERSMYLE LALAAMDEFV KMAQTDEPLW FRSVEGGREI  360
LNHEEYMRSF TSCIGMRPNS FVSEASRETG MVIINSLALV ETLMDSNKWA EMFPCLIART  420
STTDVISSGM GGTRNGALQL MHAELQVLSP LVPIREVNFL RFCKQHAEGV WAVVDVSIDT  480
IRETSNAPTF PNSRILPSGC LVQDMPNGYS KVTWVEHGEY DESVIHHLYR PLISAGMGFG  540
AQRWVATLQR QCECLAILMS STVSSRDHTA ITPSGRRSML KLAQRMTNNF CAGVCASTVH  600
KWNKLCAGNV DEDVRVMTRK SVDDPGEPPG IVLSAATSVW LPISPQRLFD FLRDERLRSE  660
WDILSNGGPM QEMAHIAKGQ DHGNCVSLLR ASAINANQSS MLILQETCID AAGALVVYAP  720
VDIPAMHVVM NGGDSAYVAL LPSGFSIVPD GPGSRGSSTA NCGSNNDGPD QRISGSLLTV  780
AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALHCE S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2221850.0GQ222185.1 Solanum lycopersicum cultivar M82 cutin deficient 2 (CD2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602856.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_016490208.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein